|
MT
Research Project This Thesis Research Project is directed by Prof.Silvia Atrian and Prof.Mercè Capdevila. |
Jordi Domenech Research Project Go to Jordi's Metallothionein Research Page.
|
||||
1.-A general study on the structure-function relationship in MTs My research subject deals with the relationship between the primary structure of plant, Protozoa and Invertebrate Metallothioneins and several aspects of their molecular features, including peptide folding, metal-binding abilities, metal coordination preferences and structure, in order to get information about the chemical and geometric functional constraints defining the evolutionary paths of this family of proteins. To this aim, we aborded the characterization of the metal-binding behaviour of several representative MTs, listed here bu the methodology described in "How we study MTs".
|
2-Nematoda Caenorhabditis elegans CeMT2. 3-Insecta Drosophila melanogaster MTNA, MTNB, MTNC, MTND. 4-Echinoderma Stryngulocentrotus purpuratus SpMTA. 5-Molluscan Mytilus edulis Me10MT-IV. 6-Crustacean Homarus americanus MTH. 8-Protozoan Tetrahymena pyriformis TpMT1.
9-Sulphides in Metallothioneins |
||||
|
|
|||||
|
MT
Research Project . |
Jordi Domenech Research Project
|
||||
|
Nematoda Caenorhabditis elegans
CeMT2.
There are few data on the literature about the folding of this MT or its metal preferences. The presence of a C-terminal Histidine is not habitual in MTs, and our first results show that this Histidine residue could play a principal role in Metal cordination. This studies have been object of a communication, available at the Publications section. The characterization of the Metal-binding habilities of CeMT2 is a collaboration between the UB and UAB Research groups, directed by Prof. Mercè Capdevila and Prof. Silvia Atrian.
|
MVCKCDCKNQNCSCNTGTKDCDCSDAKCCEQYCCPTASEKKCCKSGCAGGCKCANCECAQAAH ![]()
|
||||
|
Go to next slide /
Back to the beggining /
Go to Principal Slides 1, 2, 3, 4, 5, 6, 7, 8, 9, 10
|
|||||
|
MT
Research Project . |
Jordi Domenech Research Project
|
||||
|
Drosophila melanogaster MTNA, MTNB, MTNC, MTND
MTNA and MTNB Drosophila MT forms show a preference for cooper, and Drosophila reveals to be the first metazoan which have not a Zn-preferent MT described. We are working in the characterization of two new Drosophila MT isoforms, MTNC and MTND. The functional characterization of Drosophila MT forms is being performed in a collaboration between the UAB Research Group of Prof. Mercè Capdevila, the UB Research group of Prof. Silvia Atrian and the Research Group of Prof. Walter Schaffner, of Zurich University.
|
MTNA MPCPCGSGCKCASQATKGSCNCGSDCKCGGDKKSACGCSE MTNB MVCKGCGTNCQCSAQKCGDNCACNKDCQCVCKNGPKDQCCSNK MTNC MVCKGCGTNCKCQDTKCGDNCACNQDCKCVCKNGPKDQCCKSK MTND MGCKACGTNCQCSATKCGDNCACSQQCQCSCKNGPKDKCCSTKN
|
||||
|
Go to next slide /
Back to the beggining /
Go to Principal Slides 1, 2, 3, 4, 5, 6, 7, 8, 9, 10
|
|||||
|
MT
Research Project . |
Jordi Domenech Research Project
|
||||
|
Stryngulocentrotus purpuratus SpMTA
Echinoderma MT structure have been described by other groups, showing that, as primary sequence suggested, this MT is composed by the canonical two domains (alpha and beta) structure, but ordered in the opposite sense of mammalian MT. In spite of only little differences should be expectable, our results show some differences with the metal-binding behauviour of the canonical mammalian MTs, so suggesting that the participation of alpha and beta domains in the structure of the whole molecule is not additive. Results are yet under evaluation. The characterization of the Metal-binding habilities of SpMTA is being performed as a collaboration between UAB Research Group of Prof. Mercè Capdevila and the UB Research Group of Prof.Sílvia Atrian
|
MPDVKCVCCTEGKECACFGQDCCVTGECCKDGTCCGICTNAACKCANGCKCGSGCSCTEGNCAC
|
|||
|
|
Go to next slide /
Back to the beggining /
Go to Principal Slides 1, 2, 3, 4, 5, 6, 7, 8, 9, 10
|
|||
|
MT
Research Project . |
Jordi Domenech Research Project
|
|||
|
Mytilus edulis Me10MT-IV. Molluscan MTs are the invertebrate MTs with a higher sequence similarity to vertebrate MT's, but doesn't present the canonical alpha and beta domains. This make of these MTs an important element of the study of the evolutionary paths of these proteins. Until this moment, most of data on molluscan MTs deals with the expression of these MTs rather than their metal-binding abilities. We are at this moment studying the metal-binding behauviour of one of these MT forms, results are yet under evaluation. The characterization of the metal-binding habilities of MeMT10-IV is being performed as a collaboration between the UAB Research Group of Prof. Mercè Capdevila and the UB Research Group of Prof.Silvia Atrian. |
MPAPCNCIETNVCICDTGCSGEGCRCGDACKCSGADCKCSGCKVVCKCSGSCACEGGCTGPSTCKCAPGCSCK
|
|||
|
Go to next slide /
Back to the beggining /
Go to Principal Slides 1, 2, 3, 4, 5, 6, 7, 8, 9, 10
|
||||
|
MT
Research Project . |
Jordi Domenech Research Project
|
|||
|
Homarus americanus MTH.
MTH have a structure composed of two domains beta, and the study of its metal binding ablities performed by the UB/UAB Research groups resulted in the proposition of a general classification of MTs regarding their Zn/Cu preferences.
New data related to Cu-aggregates and the participation of other ions are under evaluation in the frame of the collaboration between these two Research Groups.
|
MPGPCCKDKCECAEGGCKTGCKCTSCRCAPCEKCTSGCKCPSKDECAKTCSKPCKCCP
|
|||
|
Go to next slide /
Back to the beggining /
Go to Principal Slides 1, 2, 3, 4, 5, 6, 7, 8, 9, 10
|
||||
|
MT
Research Project . |
Jordi Domenech Research Project
|
|||
|
Quercus suber QsMT.
Nearly 200 plant MT's have been described, but few studies focuse on their metal-binding abilities, and there are very few experimental data useful to describe the folding model of these exceptional MTs. Most of the plant MTs show a conserved "spacer" domain devoid of Cysteines, with an unknown function. As a result from the research collaboration between the Cork Research group of Prof. Marissa Molinas from the University of Girona, the UB Research group of Prof.silvia Atrian and the UAB Research Group of Prof Mercè Capdevila, in a recent publication (available at the Publications section) we propose a folding model for QsMT, the first complete characterization of a plant MT with Zn, Cu and Cd.
|
MSCCGGNCGCGTGCKCGSGCGGCKMFPDISSEKTTTETLIVGVAPQKTHFEGSEMGVGAENGCKCGSNCTCDPCNCK
|
|||
|
Go to next slide
/ Back to the beggining /
Go to Principal Slides 1, 2, 3, 4, 5, 6, 7, 8, 9, 10
|
||||
|
MT
Research Project . |
Jordi Domenech Research Project
|
|||
|
Tetrahymena pyriformis TpMT1.
Tetrahymena genera have 5 MTs forms.4 out 5 of these isoforms present a special sequence motif: Cys triplets. This special sequence motif is only present in three other species: Eisenia foetida, Callinestes sapidus, Crassostea gigas, and could present special features on metal cordination. Our studies have been object of a recent communication, available at the Publications section. The characterization of the Metal-binding habilities of TpMT1 is being performed as a collaboration between the UAB Research Group of Prof. Mercè Capdevila and the UB Research Group of Prof.Silvia Atrian.
|
MDKVNNNCCCGENAKPCCTDPNSGCCCVSETNNCCKSDKKECCTGTGEGCKCTGCKCCQPAK-SGCCCGDKAKACCTDPNSGCCCSSKTNKCCDSTNKTECKTCECCK
|
||
|
Go to next slide /
Back to the beggining /
Go to Principal Slides 1, 2, 3, 4, 5, 6, 7, 8, 9, 10
|