| Human | |
| Cys-rich domains | 4 |
| N-glycos. sites | 6 |
| Censerved cysteines | 56 |
| Total cysteines | 56 |
| Pred. mw from sequence | 82,6 |
| Size (non reduced) | 90 |
| Size (reduced) | 95 |
| Number of aa | 747 |
| Number of aa cyto domain | 46 |
| Size mRNA | 3 |
| Chromosome | 21q22 |
The beta-2 subunit is also known as CD18, and expressed on leukocytes. For this integrin subunit there's a mouse available that has a reduced expression. These mice are viable with an impairment of white bloodcell function ( Wilson et al., 1993. J. Immunol. 151, 1571-1578 ).
| Human Beta-2 | KALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNNPKFAES |
| Accession # | Description | Reference |
| L13592 | Xenopus beta-2 mRNA. partial | Unpublished |
Antibody's against the beta-2 subunit
| Name | Against | Species | Type | Reference | Com. |
| H52 | Beta-2 (Hu) | Mouse | Mono | Eur. J. Immunol. 13, 202-208 | - |
| M18/2.a.12.7 | Beta-2 (Ms) | Rat | Mono | J. Exp. Med. 158, 586-602 | - |
| TS1/18.1.2.11.4 | Beta-2 (Hu) | Mouse | Mono | PNAS 79, 7489-7493 | - |
| R3.3 | Beta-2 (Hu) | Mouse | Mono | Reference | Yes |
| P4H9 | Beta-2 (Hu) | Mouse | Mono | Reference | Yes |
| YTS213.1 | Beta-2 (Ms) | Rat | Mono | Reference | Yes |
| 2F4/11 | Beta-2 | Species | Mono | Bullido et al., 1996. J. Immunol. Methods 195, 125-134 | - |
| YFC118.3 | Beta-2 (hu) | Rat | Mono | Reference | Yes |
| WT.3 | Beta-2 (rt) | Mouse | Mono | Reference | Yes |
| 6G2 | Beta-2 (rt) | Mouse | Mono | Reference | Yes |
| C17/6 | Beta-2 (ms) | Rat | Mono | Reference | Yes |
