| Human | |
| Cys-rich domains | 4 |
| N-glycos. sites | 6 |
| Censerved cysteines | 56 |
| Total cysteines | 56 |
| Pred. mw from sequence | 84,5 |
| Size (non reduced) | 95 |
| Size (reduced) | 115 |
| Number of aa | 762 |
| Number of aa cyto domain | 47 |
| Size mRNA | 6 |
| Chromosome | 17q21-q23 |
The beta-3 subunit is also known as CD61 and is expressed on platelets.
| Human Beta-3 | KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT |
| Accession # | Description | Reference |
| J02703 | Human beta-3A mRNA, complete coding sequence. | Fitzgerald et al., 1987. J. Biol. Chem. 262, 3936-3939 |
| M32686 | Human beta-3A | Zimrin et al., 1990. J. Biol. Chem. 265, 8590-8595 |
| M25108 | Human beta-3B 3' mRNA. | van Kuppevelt et al., 1989. PNAS 86, 5415-5418 |
| L13591 | Xenopus beta-3 mRNA. | Ransom et al., 1993. Dev. Biol. 160, 265-275 |
Antibody's against the beta-3 subunit
| Name | Against | Species | Type | Reference | Com. |
| C17 | Beta-3 | Mouse | Mono | Tetteroo et al., 1983. Br. J. Haematol. 55, 509-522 | |
| 2C9.G2 | Beta-3 (ms/rt) | Hamster | Mono | Pharmingen #01861D | Yes |
| BB10 | Beta-3 (Hu) | Mouse | Mono | Reference | Yes |
| 25E11 | Beta-3 (Hu) | Mouse | Mono | Reference | Yes |
| PM6/13 | Beta-3 (hu) | Mouse | Mono | Reference | Yes |
| F11 | Beta-3 (rt) | Mouse | Mono | Reference | Yes |
