| Human | |
| Cys-rich domains | 4 |
| N-glycos. sites | 8 |
| Conserved cysteines | 56 |
| Total cysteines | 56 |
| Pred. mw from sequence | 86 |
| Size (non reduced) | 97 |
| Size (reduced) | 110 |
| Number of aa | 776 |
| Number of aa cyto domain | 57 |
| Size mRNA | 3,5 |
| Chromosome | - |
| Human Beta-5 | KLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTFNKFNKSYNGTVD |
| Accession # | Description | Reference |
| M35011 | Human beta-5 mRNA. Complete coding sequence | Suzuki et al., 1990. PNAS 87, 5354-5358 |
| J05633 | Human beta-5 mRNA. Complete coding sequence | McLean et al., 1990. J. Biol. Chem. 265, 17126-17131 |
Antibody's against the beta-5 subunit
| Name | Against | Species | Type | Reference |
