| Human | |
| Cys-rich domains | 4 |
| N-glycos. sites | 9 |
| Conserved cysteines | 56 |
| Total cysteines | 56 + 2c |
| Pred. mw from sequence | 85,9 |
| Size (non reduced) | 100-110 |
| Size (reduced) | - |
| Number of aa | 788 |
| Number of aa cyto domain | 58 |
| Size mRNA | - |
| Chromosome | - |
| Human Beta-6 | KLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC |
| Accession # | Description | Reference |
| A26609 | Human beta-6 | Patent number WO9212236-A/10, 23-JUL-1992 |
| M35198 | Human beta-6 mRNA. Complete coding sequence | Sheppard et al., 1990. J. Biol. Chem. 265, 11502-11507 |
| M35197 | Cavia beta-6 mRNA. Partial coding sequence | Sheppard et al., 1990. J. Biol. Chem. 265, 11502-11507 |
| L13468 | Xenopus beta-6. Partial | Ransom et al. 1993. Dev. Biol. 160, 265-275 |
Antibody's against the beta-6 subunit
| Name | Against | Species | Type | Reference |
