| Human | |
| I-domain | No |
| N-glycos. sites | 13 |
| Conserved cysteines | 18 |
| Total cysteines | 18 + 1c |
| Pred. mw from sequence | 113,5 |
| size (non reduced) | 150 |
| Size (reduced) | 135 + 30 |
| Metal binding sites | 3 |
| Number of aa | 1019 |
| Number of aa cyto domain | 37 |
| Size mRNA | 5 |
| Chromosome | 17 |
The alpha-3 subunit is also known as CD49c. This integrin exists in two different splice variants, denoted as "A" and "B". The only difference that results from this differential splicing is a total change in the cytoplasmic domain, while the extracellular domain stays the same.
For this integrin subunit, there's also a knockout mouse available. Mice lacking this subunit show prenatal lethality and abnormalities in the kidneys.
| Alpha-3A human | KCGFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY |
| Alpha-3A mouse | KCGFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY |
| Alpha-3A hamster | KCGFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY |
| Alpha-3A chick | KCGFFRRASTRAMYEAKRQKAEMRIQPSETERLTDDY |
| Accession # | Description | Reference |
| M59911 | Human alpha-3 mRNA. Complete coding sequence | Takada et al., 1991. J. Cell Biol. 115, 257-266 |
| D13867 | Mouse alpha-3 mRNA. | .Takeuchi et al., 1995. J. Cell. Biochem. 57, 371-377 |
| S66292 | Mouse alpha-3A mRNA Partial, 580 nt | Tamura et al., 1991. PNAS 88, 10183-10187 |
| S66294 | Mouse alpha-3B mRNA Partial, 436 nt | Tamura et al., 1991. PNAS 88, 10183-10187 |
| J05281 | Hamster alpha-3 mRNA, complete coding sequence | Tsuji et al., 1990. J. Biol. Chem. 265, 7016-7021 |
| L43057 | Xenopus alpha-3 mRNA, complete coding sequence | Meng et al. Unpublished |
| Name | Against | Species | Type | Reference | Com |
| J143 | Alpha 3 (mouse/rat) | Mouse | Mono | Kantor et al., 1987. J. Biol. Chem. 262, 15158-15165 | |
| P1B5 | Alpha 3 (human) | Mouse | Mono | Wayner and Carter, 1987. J. Cell Biol. 105, 1873-1884 | yes |
| 8-4 | Alpha-3 | Rabbit | Poly | Di Persio et al., 1995. J. Cell. Sci. 108, 2321-2336 | |
| Polycl alpha-3 | Alpha-3 c | Rabbit | Poly | Tarone | |
| P1F2 | Alpha-3 | Species | Mono | Carter et al., 1990. J. Cell. Biol. 110, 1387- | |
| M-KID-2 | Alpha-3 | Species | Mono | Bartolazzi et al., 1991. Hybridoma. 10, 707- | |
| A3-IVA5 | Alpha-3 | Species | Mono | Weitzman et al., 1993. J. Biol. Chem. 268, 8651- | |
| A3-IC10 | Alpha-3 | Species | Mono | Weitzman et al., 1993. J. Biol. Chem. 268, 8651- | |
| A3-IIF5 | Alpha-3 | Species | Mono | Weitzman et al., 1993. J. Biol. Chem. 268, 8651- | |
| A3-X8 | Alpha-3 | Species | Mono | Weitzman et al., 1993. J. Biol. Chem. 268, 8651- | |
| 11GS | Alpha-3 (hu) | Mouse | Mono | Reference | Yes |
