| Human | |
| I-domain | No |
| N-glycos. sites | 12 |
| Conserved cysteines | 19 |
| Total cysteines | 24 |
| Pred. mw from sequence | 111 |
| size (non reduced) | 140 |
| Size (reduced) | 150 |
| Metal binding sites | 3 |
| Number of aa | 999 |
| Number of aa cyto domain | 32 |
| Size mRNA | 5-6 |
| Chromosome | 2q31-q32 |
The alpha-4 subunit is also known as CD49d. For this integrin subunit there's also a knockout mouse available. Mice lacking this subunit show embryonic lethality and abnormal formation of the placenta or heart ( Yang et al., 1995. Development 121, 549-560 ).
| Alpha-4 human | KAGFFKRQYKSILQEENRRDSWSYINSKSNDD |
| Accession # | Description | Reference |
| X53176 | Mouse alpha-4 mRNA | Neuhaus et al., 1991. J. Cell Biol. 115, 1149-1158 |
| L12002 | Human alpha-4 mRNA. Complete coding sequence | Takada et al., 1989. EMBO J. 8, 1361-1368 |
| U34800 | Mouse alpha-4 mRNA. Exon 28 and complete coding sequence | De Meirsman et al., 1994. DNA Cell Biol. 13, 743-754 |
| U54497 | Xenopus alpha-4 mRNA. Complete coding sequence | Whittaker et al., 1996. Unpublished |
| Name | Against | Species | Type | Reference | Com. |
| B5G10 | Alpha-4 | Mono | Hemler et al., 1987. J. Biol. Chem. 262, 11478- | ||
| HP1/7 | Alpha-4 | Species | Mono | Sanchez-Madrid et al., 1986. Eur. J. Immunol. 16, 1343- | |
| HP2/4 | Alpha-4 | Species | Mono | Sanchez-Madrid et al., 1986. Eur. J. Immunol. 16, 1343- | |
| P4G9 | Alpha-4 (hu) | Mouse | Mono | Reference | yes |
| P4C2 | Alpha-4 (hu) | Mouse | Mono | Reference | yes |
| PS/2 | Alpha-4 (ms) | Rat | Mono | Miyake et al., 1991. J. Exp. Med. 173, 599-607 | Yes |
| 44H6 | Alpha-4 (hu) | Mouse | Mono | Reference | Yes |
| HP2/1 | Alpha-4 (hu/rt) | Mouse | Mono | Reference | Yes |
| TA-2 | Alpha-4 (rt) | Mouse | Mono | Reference | Yes |
| MRalpha4-1 | Alpha-4 (rt) | Mouse | Mono | Reference | Yes |
| R1-2 | Alpha-4 (ms) | Rat | Mono | Reference | Yes |
| 9C10 | Alpha-4 (ms) | Rat | Mono | Reference | Yes |
| 9F10 | Alpha-4 (hu) | Mouse | Mono | Reference | Yes |
