| Human | |
| I-domain | No |
| N-glycos. sites | 13 |
| Conserved cysteines | 18 |
| Total cysteines | 18 |
| Pred. mw from sequence | 112,7 |
| size (non reduced) | 150 |
| Size (reduced) | 125 + 25 |
| Metal binding sites | 4 |
| Number of aa | 1018 |
| Number of aa cyto domain | 32 |
| Size mRNA | 7 |
| Chromosome | 2q31-q32 |
The alpha-V subunit is also known as CD51.
| Human Alpha-V | RMGFFKRVRPPQEEQEREQLQPHENGEGNSET |
| Accession # | Description | Reference |
| U14135 | Mouse alpha-V mRNA. Complete coding sequence | Wada et al., 1996. J. Cell Biol. 132, 1161-1176 |
| Name | Against | Species | Type | Reference | Com. |
| NKI-M9 | Alpha-V (hu) | Mouse | Mono | Von dem Borne et al., 1989. Leukocyte typing IV | |
| Polycl alphaV | Alpha-V (rt/ms) | Rabbit | Poly | Tarone | |
| H9.2B8 | Alpha-V (ms) | Hamster | Mono | Pharmingen #01521D | Yes |
| VNR-147 | Alpha-V (hu) | Mouse | Mono | Reference | yes |
| VNR-139 | Alpha-V (hu) | Mouse | Mono | Reference | yes |
| LM-142 | Alpha-V (hu) | Mouse | Mono | Reference | yes |
| CLB-706 | Alpha-V (hu) | Mouse | Mono | Reference | yes |
| P3G8 | Alpha-V | Mouse | Mono | Reference | yes |
