Beta-7 integrin subunit

Factsheet

Human
Cys-rich domains4
N-glycos. sites8
Conserved cysteines54
Total cysteines54
Pred. mw from sequence84,7
Size (non reduced)105
Size (reduced)120
Number of aa778
Number of aa cyto domain52
Size mRNA3,5
Chromosome-

Amino acid sequences of cytoplasmic domain

Human Beta-7 RLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKSAITTTINPRFQEADSPTL

Genbank sequences (EMBL) which exist for this integrin subunit
Accession # Description Reference
M68892 Human beta-7 mRNA. Complete coding sequence Yuan et al., 1990. Int. Immunol. 2, 1097-1108
M62880 Human beta-7 mRNA. Complete coding sequence Erle et al., 1991. J. Biol. Chem. 266, 11009-11016
M95632 Mouse beta-7 mRNA. Complete coding sequence Hu et al., 1992. PNAS 89, 8254-8258
M95633 Mouse beta-7 mRNA. Complete coding sequence Hu et al., 1992. PNAS 89, 8254-8258
M68903 Mouse beta-7 mRNA. Complete coding sequence Yuan et al., 1992. J. Biol. Chem. 267, 7352-7358

Antibody's against the beta-7 subunit
Name Against Species Type Reference
M293 Beta-7 (ms) Rat Mono Reference Yes
FIB27 Beta-7 (ms) Rat Mono Reference Yes

Last updated on 03/10/97

© 1997 jkoster@hotmail.com


Back to The Integrin Page

This page hosted by GeoCities