| Human | |
| Cys-rich domains | 4 |
| N-glycos. sites | 7 |
| Conserved cysteines | 50 |
| Total cysteines | 50 +2c |
| Pred. mw from sequence | 80,1 |
| Size (non reduced) | 95 |
| Size (reduced) | 97 |
| Number of aa | 769 |
| Number of aa cyto domain | 65 |
| Size mRNA | 8,5 |
| Chromosome | - |
| Human Beta-8 | KVLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF |
| Accession # | Description | Reference |
| M73780 | Human beta-8 mRNA. Complete coding sequence | Moyle et al., 1991. J. Biol. Chem. 266, 19650-19658 |
| M73781 | Eur. Rabbit beta-8 mRNA. Complete coding sequence | Moyle et al., 1991. J. Biol. Chem. 266, 19650-19658 |
Antibody's against the beta-8 subunit
| Name | Against | Species | Type | Reference |
